DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and rps10

DIOPT Version :9

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_957440.1 Gene:rps10 / 394121 ZFINID:ZDB-GENE-040426-1481 Length:166 Species:Danio rerio


Alignment Length:161 Identity:94/161 - (58%)
Similarity:111/161 - (68%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSEL-DK-IPNLQVIKVMQSLNSRGWVKEQFAWR 63
            |.:||.||:||||.||||||:|||||..:.||.|| || :|||.|:|.||||.|.|:||||||||
Zfish     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHLAKHPELADKNVPNLHVMKAMQSLKSCGYVKEQFAWR 65

  Fly    64 HFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGG-PGGGFGGASKTDDDRSNY 127
            ||||.||||||:.||.:|||||||||:||.:.||....|||  |.| .|......::.:.||..|
Zfish    66 HFYWYLTNEGIQYLRDFLHLPPEIVPATLRRQTRPETARPR--PKGLEGERPARLARGEGDRDAY 128

  Fly   128 RRGPGAYGMDKKGDVGAGTG-RVEYRGGFGR 157
            ||.....|.|||.:.|||.. ..::||||||
Zfish   129 RRSAAQPGADKKAEAGAGAATEFQFRGGFGR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 67/94 (71%)
rps10NP_957440.1 S10_plectin 3..97 CDD:397530 67/93 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4356
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3712
OMA 1 1.010 - - QHG53709
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - otm26434
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - O PTHR12146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.