DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and RGD1560073

DIOPT Version :9

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:XP_038934115.1 Gene:RGD1560073 / 314054 RGDID:1560073 Length:165 Species:Rattus norvegicus


Alignment Length:160 Identity:90/160 - (56%)
Similarity:109/160 - (68%) Gaps:7/160 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSEL-DK-IPNLQVIKVMQSLNSRGWVKEQFAWR 63
            |.:||.||:||||.||||||:|||||..:.||.|| || :|||.|:|.||||.|||:|||||||.
  Rat     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELTDKNVPNLHVMKSMQSLKSRGYVKEQFAWT 65

  Fly    64 HFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGGPGGGFGGA-SKTDDDRSNY 127
            ||||.||||||:.|:.||||.|||||:|.: .:.....|||  |.||.|.:... ::...||..|
  Rat    66 HFYWYLTNEGIQYLQDYLHLLPEIVPATFS-LSHPETGRPR--PKGPEGKWPARFTRGKADRDTY 127

  Fly   128 RRGPGAYGMDKKGDVGAGTG-RVEYRGGFG 156
            ||.....|.|||.:.|||:. ..::|||||
  Rat   128 RRSAVPPGADKKAESGAGSATEFQFRGGFG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 65/94 (69%)
RGD1560073XP_038934115.1 S10_plectin 3..94 CDD:397530 64/90 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12146
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.