DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and rps-10

DIOPT Version :9

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_491398.1 Gene:rps-10 / 172061 WormBaseID:WBGene00004479 Length:149 Species:Caenorhabditis elegans


Alignment Length:166 Identity:75/166 - (45%)
Similarity:93/166 - (56%) Gaps:28/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAWRHF 65
            |||||::...||||||.|||.|||||...:.|..::.:.||:|||.::||.||..|||||||||:
 Worm     1 MFIPKSHTKLIYEYLFNEGVTVAKKDFNAKTHPNIEGVSNLEVIKTLKSLASRELVKEQFAWRHY 65

  Fly    66 YWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVR-------PRGGPGGPGGGFGGASKTDDD 123
            ||.||:.||..||.||.||.||||:|:  .|:...:|       ||...|..|           |
 Worm    66 YWYLTDAGILYLREYLALPAEIVPATI--KTKPREIRVPHEDRAPRAAQGEKG-----------D 117

  Fly   124 RSNYRRGPGAYGMDKKGDVGAGTGRVEYRGGFGRAS 159
            |..||       .:|..:.|.| |...||.||||.:
 Worm   118 REAYR-------TEKVTEAGPG-GAPVYRAGFGRGA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 53/92 (58%)
rps-10NP_491398.1 S10_plectin 3..95 CDD:367530 53/93 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158195
Domainoid 1 1.000 131 1.000 Domainoid score I3202
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2934
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53709
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - otm14147
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - O PTHR12146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.