DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RHO5

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_014219.1 Gene:RHO5 / 855541 SGDID:S000005124 Length:331 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:102/221 - (46%)
Similarity:129/221 - (58%) Gaps:42/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNY-----------SAPMQVDTIQ----- 53
            |.||||::|||.||||.:||||||:.||.:|||||||||           |:|:::|...     
Yeast     2 RSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNGNDKRGS 66

  Fly    54 --------------VSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEI 104
                          ..:.||||||||||||||||.|||||:||||:||:..:||.|||.||.||:
Yeast    67 LSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASFANVTEKWLPEL 131

  Fly   105 KH-----------HCPDAPIILVGTKIDLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYM 158
            |.           .....||:|||||.|||:|..|...|.|.....:.:|:..:|..:...:.|.
Yeast   132 KQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVSQEEIDELVQRCGFMGYT 196

  Fly   159 ECSALTQRGLKPVFEEAVR-AVLRPE 183
            ||||.||.|::.|||:||| |:..||
Yeast   197 ECSAATQAGVREVFEQAVRYAIYEPE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 97/214 (45%)
RHO5NP_014219.1 RHO 6..220 CDD:197554 97/213 (46%)
PBP1 <161..>316 CDD:227507 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.