DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhoq

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_038934034.1 Gene:Rhoq / 85428 RGDID:621626 Length:355 Species:Rattus norvegicus


Alignment Length:157 Identity:81/157 - (51%)
Similarity:108/157 - (68%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQED 66
            :|||.::          :.|.: ||..|.||.||||||||:|:..:.|...|...||:|||||||
  Rat   205 ATGRWVR----------RACFM-SYANDAFPEEYVPTVFDHYAVSVTVGGKQYLFGLYDTAGQED 258

  Fly    67 YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSG 131
            ||||||||||.|||||||:||.:|:||:||..:|.||:|.:.|:.|.:|:||:||||:|.:||:.
  Rat   259 YDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLAR 323

  Fly   132 LAEQGLTPLKREQGQKLANKIRAVKYM 158
            |.:....|:..|||||||.:|.|..|:
  Rat   324 LNDMKEKPVCVEQGQKLAKEIGACCYV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 78/150 (52%)
RhoqXP_038934034.1 P-loop_NTPase 210..350 CDD:422963 77/150 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.