DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RHO4

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_012981.3 Gene:RHO4 / 853929 SGDID:S000001763 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:91/227 - (40%)
Similarity:121/227 - (53%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQ-VSLGLWDTAGQEDYDRL 70
            :|.||||||.|||||:||||....||.:|:||:|:||...::....| :.|.||||||||:|.||
Yeast    73 LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRL 137

  Fly    71 RPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQ 135
            |||||...||.::||||.|.:|.:||...|:||:||.||..||:|||.|.||.| .:.||.|.|.
Yeast   138 RPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYE-ADNLSDLVEP 201

  Fly   136 GLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLR-------------PEPLKR 187
                   ...:.||.::.|..:::|||..:..:..|||.|:..:|.             ..|.||
Yeast   202 -------SSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLSDSLYAPREPTHTIKNPFKR 259

  Fly   188 ------------------------RQRKCLIM 195
                                    |:.||:||
Yeast   260 NTTRSDIDSSTGDTSVSISGTKRLRKNKCIIM 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 82/186 (44%)
RHO4NP_012981.3 Rho4_like 70..248 CDD:206704 83/182 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.