DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and ROP2

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_173437.1 Gene:ROP2 / 838598 AraportID:AT1G20090 Length:195 Species:Arabidopsis thaliana


Alignment Length:194 Identity:101/194 - (52%)
Similarity:141/194 - (72%) Gaps:5/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDR 69
            |.||||.||||.|||||||||||::.||.:||||||||:||.:.||...|:||||||||||||:|
plant     4 RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNR 68

  Fly    70 LRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAE 134
            ||||||...|||::.:|:.|.:|:||:..||.||::|:.|..||||||||:|||:|::..  :..
plant    69 LRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFF--IDH 131

  Fly   135 QGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQR---KCLIM 195
            .|..|:...||::|...|.:..|:|||:.||:.:|.||:.|::.||:|...|::::   :|..:
plant   132 PGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCAFL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 95/172 (55%)
ROP2NP_173437.1 Rop_like 5..177 CDD:206705 95/173 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128946
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.