DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RAN4

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_200319.1 Gene:RAN4 / 835599 AraportID:AT5G55080 Length:222 Species:Arabidopsis thaliana


Alignment Length:157 Identity:42/157 - (26%)
Similarity:75/157 - (47%) Gaps:19/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            |.::||||..|||..|..:.|..|.....||: .|.|......:..::....|||||||.|..|:
plant    15 KLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDTAGQEKYSGLK 79

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            ...|......:|.:.|.:..::.|: .:||.:::..|.:.||:|.|.|:|:              
plant    80 DAYYIHGQCAIIMFDVTARHTYMNI-DRWYRDLRRVCKNIPIVLCGNKVDV-------------- 129

  Fly   137 LTPLKREQGQKLA-NKIRAVKYMECSA 162
              |.::.:.:.:: ::.:.::|.|.||
plant   130 --PSRQIKPKHVSYHRKKCLQYYEMSA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 41/156 (26%)
RAN4NP_200319.1 PLN03071 1..219 CDD:178620 42/157 (27%)
Ran 14..179 CDD:206643 42/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.