DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RAC2

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_199409.1 Gene:RAC2 / 834637 AraportID:AT5G45970 Length:201 Species:Arabidopsis thaliana


Alignment Length:203 Identity:112/203 - (55%)
Similarity:145/203 - (71%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQE 65
            |||.|.||||.||||.|||||||||||::.||.:||||||||:||.:.||...|:||||||||||
plant     1 MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQE 65

  Fly    66 DYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLS 130
            ||:|||||||...||||:.:|:.|.:|:||:..||.||:||:.|..||:|||||:|||:|::.|.
plant    66 DYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLK 130

  Fly   131 GLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRP-------EPLK-R 187
            .  ..|...:...||::|...|.||:|:|||:.||:.:|.||:.|:|..|||       :||| :
plant   131 D--HPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALRPPKAKKKIKPLKTK 193

  Fly   188 RQRKCLIM 195
            |.|.|..:
plant   194 RSRICFFL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 98/172 (57%)
RAC2NP_199409.1 Rop_like 6..178 CDD:206705 99/173 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 1 0.900 - - OOG6_100633
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.