DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and ARAC9

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_566024.1 Gene:ARAC9 / 819077 AraportID:AT2G44690 Length:209 Species:Arabidopsis thaliana


Alignment Length:185 Identity:100/185 - (54%)
Similarity:134/185 - (72%) Gaps:3/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            ||||.||||.|||||:|||||::.||.:||||||||::|.:.||...|:||||||||||||:|:|
plant    19 IKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFNANVLVDGKTVNLGLWDTAGQEDYNRVR 83

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            ||||...|||::.:|:.|..||||:..||.||::|:.|..||:|||||.|||::.:.....  .|
plant    84 PLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYAPTVPIVLVGTKSDLRDNMQFPKNY--PG 146

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRK 191
            ...:..||||:|..:|.|:.|:|||:..|..:|.||:||::.||.| |.|.::||
plant   147 ACTIFPEQGQELRKEIGALAYIECSSKAQMNVKAVFDEAIKVVLHP-PSKTKKRK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 93/172 (54%)
ARAC9NP_566024.1 Rop_like 18..190 CDD:206705 93/172 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 1 0.900 - - OOG6_100633
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.