DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhobtb2a

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_001332198.5 Gene:rhobtb2a / 792631 ZFINID:ZDB-GENE-081105-67 Length:543 Species:Danio rerio


Alignment Length:215 Identity:83/215 - (38%)
Similarity:121/215 - (56%) Gaps:34/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTGRP----IKCVVVGDGTVGKTCMLISYTTDCFPGEY------VPTVF--DNYSAPMQ----- 48
            |...||    ||||||||..||||.::.:...:....:|      ||||:  |.|....:     
Zfish    29 MDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERS 93

  Fly    49 ---VDTIQVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPD 110
               ||.:.|||.||||.|  |:.:.|..:|.::||.::|:|:|:|:|..:|.:.|||||||.||.
Zfish    94 RDVVDDVSVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLHHVRTMWYPEIKHFCPR 156

  Fly   111 APIILVGTKIDLR-EDRETLSGLAEQGLTPLKR------EQGQKLANKIRAVKYMECSALTQRGL 168
            ||:||||.::||| .|.|.::........|:|.      |:|:::|.:: .|.|.|.|.:.|.|:
Zfish   157 APVILVGCQLDLRYADLEAVNRARRPLARPIKSNEILAPEKGREVAKEL-GVPYYETSIVAQFGV 220

  Fly   169 KPVFEEAVRAVLRPEPLKRR 188
            |.||:.|:||.|    :.||
Zfish   221 KDVFDNAIRAAL----ISRR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 76/195 (39%)
rhobtb2aXP_001332198.5 RhoBTB 37..231 CDD:133275 76/196 (39%)
RHO 41..232 CDD:197554 75/193 (39%)
BTB 283..>321 CDD:295341
BTB <407..468 CDD:295341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.