DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhoh

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001074574.1 Gene:Rhoh / 74734 MGIID:1921984 Length:191 Species:Mus musculus


Alignment Length:187 Identity:83/187 - (44%)
Similarity:122/187 - (65%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            ||||:|||..||||.:|:.:|::.||..|.|||::|....:.:|.||:|||||||||.:.:..:|
Mouse     5 IKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIR 69

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            ||||.|.||.|:|||||:.:||.|:.:||..||:.:.|..|:::|.|:.|.||       :....
Mouse    70 PLSYQQADVVLMCYSVANHNSFLNLKNKWISEIRSNLPCTPVLVVATQTDQRE-------VGPHR 127

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKCL 193
            .:.:...:|::||..:||..|:|||||:.||::.|||.|||..:  ...:||.|:.|
Mouse   128 ASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAV--NQARRRNRRKL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 77/172 (45%)
RhohNP_001074574.1 Rho 5..169 CDD:206641 78/170 (46%)
Effector region. /evidence=ECO:0000250 33..41 4/7 (57%)
Interaction with ZAP70. /evidence=ECO:0000269|PubMed:17028588 73..86 8/12 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.