DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhof

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_001073389.2 Gene:Rhof / 690130 RGDID:1584038 Length:211 Species:Rattus norvegicus


Alignment Length:197 Identity:86/197 - (43%)
Similarity:125/197 - (63%) Gaps:3/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQED 66
            |..:.:|.|:||||..|||.:|:.|....||..|.|:||:.|:|.:.|...:|:|.|:|||||||
  Rat    15 SARKELKIVIVGDGGCGKTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNLYDTAGQED 79

  Fly    67 YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSG 131
            |||||||||..|.:.||||.|.:|:|::||..||:||:.|.|...|::|:|.|.|||:|:|.|..
  Rat    80 YDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRK 144

  Fly   132 LAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVR---AVLRPEPLKRRQRKCL 193
            |....|.|:...||.....::|...|:||||..:..::.||.||.:   :.|:....:::||.||
  Rat   145 LRAAQLEPITYTQGLSACEQMRGALYLECSAKFRENVEDVFREATKVALSALKKAQRQKKQRICL 209

  Fly   194 IM 195
            ::
  Rat   210 LL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 80/175 (46%)
RhofXP_001073389.2 Rho4_like 17..211 CDD:206704 85/193 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.