DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhou

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_038954118.1 Gene:Rhou / 678766 RGDID:1596918 Length:261 Species:Rattus norvegicus


Alignment Length:192 Identity:101/192 - (52%)
Similarity:137/192 - (71%) Gaps:5/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYD 68
            ||.:|||:||||.||||.:::||||:.:|.||:||.|||:||.:.||...|.|.|.|||||:::|
  Rat    50 GRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFD 114

  Fly    69 RLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLA 133
            :||||.|..||:||:|:||.||:||:||..||.|||:.|||.||||||||:.|||||.:.|..|.
  Rat   115 KLRPLCYTNTDIFLLCFSVVSPTSFQNVGEKWVPEIRRHCPKAPIILVGTQSDLREDVKVLIELD 179

  Fly   134 EQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL-----RPEPLKRRQR 190
            :....|:..|..:..|.:::||.|:|||||||:.||.||:.|:.|.:     :.:|.|.:.|
  Rat   180 KCKEKPVPEEAAKLCAEEVKAVSYIECSALTQKNLKEVFDAAIVAGIQHSDSQQQPKKSKSR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 95/177 (54%)
RhouXP_038954118.1 Wrch_1 53..225 CDD:133330 95/171 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.