DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RAC1

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_061485.1 Gene:RAC1 / 5879 HGNCID:9801 Length:211 Species:Homo sapiens


Alignment Length:208 Identity:136/208 - (65%)
Similarity:165/208 - (79%) Gaps:19/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            |||||||||.|||||:||||||:.|||||:|||||||||.:.||...|:||||||||||||||||
Human     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLR 68

  Fly    72 PLSYPQT-------------------DVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVG 117
            |||||||                   ||||||:|:.||:|||||.:|||||::||||:.||||||
Human    69 PLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVG 133

  Fly   118 TKIDLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRP 182
            ||:|||:|::|:..|.|:.|||:...||..:|.:|.||||:|||||||||||.||:||:||||.|
Human   134 TKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP 198

  Fly   183 EPLKRRQRKCLIM 195
            .|:|:|:||||::
Human   199 PPVKKRKRKCLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 126/191 (66%)
RAC1NP_061485.1 Rac1_like 3..195 CDD:206663 125/190 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100633
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.