DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhof

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001018478.1 Gene:rhof / 573655 ZFINID:ZDB-GENE-050522-280 Length:209 Species:Danio rerio


Alignment Length:196 Identity:87/196 - (44%)
Similarity:119/196 - (60%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            :|.|:||||..|||.:|:.|....||.:|.|:|||.|...:......:.|.|:||||||||||||
Zfish    17 LKIVIVGDGGCGKTSLLMVYAKGDFPEKYAPSVFDKYVTTVSYGGKDIQLNLYDTAGQEDYDRLR 81

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRE---TLSGLA 133
            ||||...::.||||.|.:|:||:||..|||||::|.|.||||||:..|.|||:|:|   .|..|.
Zfish    82 PLSYQDVNIVLICYDVTNPTSFDNVKIKWYPEVRHFCRDAPIILISCKTDLRKDKEKMRRLKALD 146

  Fly   134 EQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRK----CLI 194
            :..:|.|..||.||   ::.|..|:||||..:..::.:|.||.:..|......|.:.|    |.:
Zfish   147 QAPITYLLGEQTQK---EMNAEIYLECSAKYRENVEDIFREATKRALAARAKARHRSKKKKHCTV 208

  Fly   195 M 195
            :
Zfish   209 L 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 83/175 (47%)
rhofNP_001018478.1 P-loop_NTPase 17..209 CDD:304359 87/194 (45%)
RHO 19..186 CDD:197554 81/169 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.