DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhoj

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001038266.1 Gene:rhoj / 556371 ZFINID:ZDB-GENE-040724-272 Length:226 Species:Danio rerio


Alignment Length:186 Identity:106/186 - (56%)
Similarity:138/186 - (74%) Gaps:3/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            :||||||||.|||||:|:||..|.||.||:|||||:|:..:.|...|..|||:||||||||::||
Zfish    34 LKCVVVGDGAVGKTCLLMSYANDAFPEEYIPTVFDHYAVNVTVSGRQHLLGLYDTAGQEDYNQLR 98

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            |||||.|||||||:||.:|:|:.||..:|.||::...|..|.||:||:||||:|.:||:.|.:..
Zfish    99 PLSYPNTDVFLICFSVVNPASYHNVQEEWVPELRSCMPHVPYILIGTQIDLRDDPKTLARLLQMK 163

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKC 192
            ..||..|||.|||.:|.|..|:|||||||:|||.||:||:..:..|   |:::|.|
Zfish   164 EKPLTYEQGLKLAREIGAQCYLECSALTQKGLKTVFDEAILTIFSP---KKQKRGC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 101/172 (59%)
rhojNP_001038266.1 P-loop_NTPase 34..207 CDD:304359 102/172 (59%)
RHO 36..209 CDD:197554 101/172 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.