DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhobtb4

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001352487.1 Gene:rhobtb4 / 553415 ZFINID:ZDB-GENE-060315-11 Length:729 Species:Danio rerio


Alignment Length:211 Identity:80/211 - (37%)
Similarity:118/211 - (55%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RP----IKCVVVGDGTVGKTCMLISYTTDCFPGEY------VPTVF--DNYSAPMQ--------V 49
            ||    ||||||||..||||.::.:...:....:|      ||||:  |.|....:        |
Zfish    22 RPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVV 86

  Fly    50 DTIQVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPII 114
            |.:.|||.||||.|  |:.:.|..:|.::||.::|:|:|:|:|..:|.:.|:|||||.||..|||
Zfish    87 DEVSVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSLANPNSLRHVRTMWFPEIKHFCPRTPII 149

  Fly   115 LVGTKIDLR-EDRETLSGLAEQGLTPLK------REQGQKLANKIRAVKYMECSALTQRGLKPVF 172
            |||.::||| .|.:.::........|:|      .|:|.::|.:: .|.|.|.|.:.|.|:|.||
Zfish   150 LVGCQLDLRYADLDAVNRARRPLAKPIKPTDILPPERGHEVAKEL-GVPYYETSIVAQFGVKDVF 213

  Fly   173 EEAVRAVLRPEPLKRR 188
            :.|:||.|    :.||
Zfish   214 DNAIRAAL----ISRR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 74/195 (38%)
rhobtb4NP_001352487.1 RhoBTB 26..220 CDD:133275 74/196 (38%)
BTB <426..486 CDD:333434
BTB 505..612 CDD:306997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.