DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhof

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001016369.1 Gene:rhof / 549123 XenbaseID:XB-GENE-920536 Length:218 Species:Xenopus tropicalis


Alignment Length:195 Identity:87/195 - (44%)
Similarity:124/195 - (63%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDR 69
            |.:|.|:||||..|||.:|:.|....||.:|.|:||:.|:..:.:....:.|.|:||||||||||
 Frog    24 REVKIVIVGDGGCGKTSLLMVYAKGSFPEQYAPSVFEKYTTTITIGNKDIFLHLYDTAGQEDYDR 88

  Fly    70 LRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAE 134
            ||||||...::.||||.|.:|:||:||..|||||:.|.|...||:|:|.|.|||:|:|.|..|..
 Frog    89 LRPLSYQDVNLVLICYDVTNPTSFDNVLIKWYPEVHHFCRGVPIVLIGCKTDLRKDKERLRKLRT 153

  Fly   135 QGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEE----AVRAVLRPEPLKRRQRKCLIM 195
            ....|:...||:.....|:|.:|:||||..:..:..||:|    |:.|:.|.:.|||:|:.|.::
 Frog   154 AQQEPVTYFQGEDTCKSIQAAEYLECSAKYRENIDNVFKEATLIALNAMKREQKLKRKQKNCSLL 218

  Fly   196  195
             Frog   219  218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 79/176 (45%)
rhofNP_001016369.1 Rho4_like 23..218 CDD:206704 87/193 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.