powered by:
Protein Alignment Mtl and dynlt5
DIOPT Version :9
| Sequence 1: | NP_524533.1 |
Gene: | Mtl / 43319 |
FlyBaseID: | FBgn0039532 |
Length: | 195 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_004913984.1 |
Gene: | dynlt5 / 493200 |
XenbaseID: | XB-GENE-5960232 |
Length: | 177 |
Species: | Xenopus tropicalis |
| Alignment Length: | 38 |
Identity: | 9/38 - (23%) |
| Similarity: | 17/38 - (44%) |
Gaps: | 2/38 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 122 LREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYME 159
|.:.|.::|.|....:.| |....|..:.:..|.|::
Frog 12 LLKKRGSISSLGSHDVKP--RGSFSKTKDSVSTVSYID 47
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Mtl | NP_524533.1 |
RHO |
9..182 |
CDD:197554 |
9/38 (24%) |
| dynlt5 | XP_004913984.1 |
Tctex-1 |
79..175 |
CDD:367593 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000070 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X103 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.
