DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Miro

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster


Alignment Length:207 Identity:57/207 - (27%)
Similarity:88/207 - (42%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQED 66
            |..:.::.::|||..||||.:::|..::.:| |.||...:..:.|..|...||...:.|.:..|.
  Fly     7 SQRKNVRILLVGDAGVGKTSLILSLVSEEYP-EEVPPRAEEITIPANVTPEQVPTSIVDFSAVEQ 70

  Fly    67 YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHC-------PDA------------- 111
            .:........:..|..|.|:|....:.:.:||.|.|.::..|       .||             
  Fly    71 SEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREPI 135

  Fly   112 --PIILVGTKIDLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEE 174
              ||:|||.||||.|.....|.||.....|           :|.:.  :||||.:...:..:|..
  Fly   136 RKPIVLVGNKIDLIEYSTMDSVLAIMEDYP-----------EIESC--VECSAKSLHNISEMFYY 187

  Fly   175 AVRAVLRP-EPL 185
            |.:|||.| .||
  Fly   188 AQKAVLHPTSPL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 53/194 (27%)
MiroNP_001262895.1 Miro1 10..195 CDD:206680 53/198 (27%)
RHO 14..195 CDD:197554 53/194 (27%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.