DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhoac

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_998515.1 Gene:rhoac / 406659 ZFINID:ZDB-GENE-040426-2665 Length:193 Species:Danio rerio


Alignment Length:190 Identity:107/190 - (56%)
Similarity:137/190 - (72%) Gaps:5/190 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLRP 72
            |.|:||||..||||:||.::.|.||..||||||:||.|.::||:.||.|.|||||||||||||||
Zfish     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRP 71

  Fly    73 LSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQGL 137
            ||||.|||.|:|:|:.||.|.||:..||.||:||.||:.||||||.|.|||.|..|...||:...
Zfish    72 LSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQ 136

  Fly   138 TPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRK--CLIM 195
            .|:|.|:|:.:||:|.|..|:||||.|:.|::.|||.|.||.|:   .::|.:|  ||::
Zfish   137 EPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ---ARKRGKKSGCLLL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 102/172 (59%)
rhoacNP_998515.1 RhoA_like 5..179 CDD:206662 102/171 (60%)
RHO 8..181 CDD:197554 102/175 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.