DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RHOH

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001265288.1 Gene:RHOH / 399 HGNCID:686 Length:191 Species:Homo sapiens


Alignment Length:187 Identity:84/187 - (44%)
Similarity:122/187 - (65%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            ||||:|||..||||.:|:.:|::.||..|.|||::|....:.:|.||:|||||||||.:.:..:|
Human     5 IKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIR 69

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            ||||.|.||.|:|||||:.:||.|:.:||..||:.:.|..|:::|.|:.|.||       :....
Human    70 PLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQRE-------MGPHR 127

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKCL 193
            .:.:...:|:|||..:||..|:|||||:.||::.|||.|||..:  ...:||.|:.|
Human   128 ASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAV--NQARRRNRRRL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 78/172 (45%)
RHOHNP_001265288.1 Rho 5..169 CDD:206641 79/170 (46%)
Effector region. /evidence=ECO:0000250 33..41 4/7 (57%)
Interaction with ZAP70. /evidence=ECO:0000250 73..86 8/12 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.