DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RND3

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001241667.1 Gene:RND3 / 390 HGNCID:671 Length:244 Species:Homo sapiens


Alignment Length:181 Identity:80/181 - (44%)
Similarity:114/181 - (62%) Gaps:3/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTGRPIKC--VVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAG 63
            |...:.:||  |||||...|||.:|..:..||||..||||||:||:|..::||.::.|.||||:|
Human    16 MDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSG 80

  Fly    64 QEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRET 128
            ...||.:||||||.:|..|||:.::.|.:.::|..||..||:..||:..::|||.|.|||.|..|
Human    81 SPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVST 145

  Fly   129 LSGLAEQGLTPLKREQGQKLANKIRAVKYMECSAL-TQRGLKPVFEEAVRA 178
            |..|:....||:..:||..:|.:|.|..|:||||| ::..::.:|..|..|
Human   146 LVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 78/173 (45%)
RND3NP_001241667.1 Rnd3_RhoE_Rho8 19..200 CDD:206735 79/178 (44%)
Effector region. /evidence=ECO:0000255 52..60 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.