DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rab10

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster


Alignment Length:179 Identity:47/179 - (26%)
Similarity:87/179 - (48%) Gaps:24/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQ-----VSLGLWDTAGQEDY 67
            |.:::||..|||||:|..::.|.|...::.|:    ....::.|::     :.|.:|||||||.:
  Fly    11 KLLLIGDSGVGKTCILFRFSDDAFTSTFISTI----GIDFKIKTVELRGKKIKLQIWDTAGQERF 71

  Fly    68 DRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHC-PDAPIILVGTKIDLREDRETLSG 131
            ..:....|......::.|.:.:..||||:. ||...|..|. .|...:::|.|.|:.:.|     
  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIV-KWLRNIDEHANEDVEKMILGNKCDMTDKR----- 130

  Fly   132 LAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL 180
                   .:.:|:|:.:|.: ..:::||.||.:...::..|.|...|:|
  Fly   131 -------VVNKERGEAIARE-HGIRFMETSAKSNINIERAFCELAEAIL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 46/178 (26%)
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 47/179 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.