DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhobtb3

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001101115.1 Gene:Rhobtb3 / 309922 RGDID:1311683 Length:611 Species:Rattus norvegicus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:54/135 - (40%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTS 98
            ||..:.|.|      |..:.....:||....:.|.....:.  ..|:.:|.|:|....||..|..
  Rat    57 EYQASAFGN------VKLVVHDCPVWDIFDSDWYTSRNLIG--GADIIVIKYNVNDKFSFHEVKD 113

  Fly    99 KWYPEIKHHCPDAPIIL--VGTKIDLREDRE---TLSGLAEQGLTPLKREQGQKLANKIRAVKYM 158
            .:.|.||......|:|:  |||    |::.|   |.........:.:...:|.:||.::.|. |:
  Rat   114 NYIPVIKRASNSVPVIIAAVGT----RQNEELPCTCPLCTSDRGSCVTTTEGIQLAKELGAT-YL 173

  Fly   159 ECSAL 163
            |..:|
  Rat   174 ELHSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 33/135 (24%)
Rhobtb3NP_001101115.1 P-loop_NTPase 34..174 CDD:304359 31/129 (24%)
BTB 413..515 CDD:279045
BTB 421..518 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.