DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rnd2

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001010953.1 Gene:Rnd2 / 303553 RGDID:1306172 Length:228 Species:Rattus norvegicus


Alignment Length:179 Identity:79/179 - (44%)
Similarity:117/179 - (65%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDY 67
            :|| .|.|||||...|||.:|..:..|.:||.||||||:||:|..::|..::.|.:|||:|...|
  Rat     5 SGR-CKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYY 68

  Fly    68 DRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGL 132
            |.:|||:||.:|..|||:.::.|.:.::|..||..|.:..||:|.::|||.|:|:|.|..||..|
  Rat    69 DNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLREL 133

  Fly   133 AEQGLTPLKREQGQKLANKIRAVKYMECSA-LTQRGLKPVFEEAVRAVL 180
            ::|.|.|:..|||..||.::.||.|:|||: .::|.::.||..|..|.|
  Rat   134 SKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 76/173 (44%)
Rnd2NP_001010953.1 P-loop_NTPase 7..228 CDD:304359 78/177 (44%)
RHO 10..182 CDD:197554 75/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.