DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhod

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001099793.1 Gene:Rhod / 293660 RGDID:1310985 Length:210 Species:Rattus norvegicus


Alignment Length:196 Identity:89/196 - (45%)
Similarity:128/196 - (65%) Gaps:4/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDY 67
            :|||||.|:||||..|||.:::.:....||..|.||||:.|:|.:|:....|.|.:||||||:||
  Rat    14 SGRPIKVVLVGDGGCGKTSLMMVFANGAFPESYNPTVFERYNATLQMKGKPVRLQIWDTAGQDDY 78

  Fly    68 DRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGL 132
            ||||||.||..:|.|:|:.|.:|:||:||:::||||:.|.|...|||:||.|||||:|:..::.|
  Rat    79 DRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNTL 143

  Fly   133 AEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL--RPEPLKRR--QRKCL 193
            .::.|.|:...:|..:|..:.||.|:||||.....::.||:||....|  |.....||  |..|:
  Rat   144 RKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSRSHNFWRRITQNFCV 208

  Fly   194 I 194
            :
  Rat   209 V 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 79/174 (45%)
RhodNP_001099793.1 Rho4_like 16..210 CDD:206704 88/194 (45%)
RHO 20..192 CDD:197554 78/171 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.