DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and RND1

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_055285.1 Gene:RND1 / 27289 HGNCID:18314 Length:232 Species:Homo sapiens


Alignment Length:183 Identity:73/183 - (39%)
Similarity:108/183 - (59%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLRP 72
            |.|:|||...|||.||.....||:|..||||||:||:|.::.:..:|.|.||||:|...||.:||
Human    15 KLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRP 79

  Fly    73 LSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQGL 137
            |.|..:|..|:|:.::.|.:.::...||..||..:||...::|:|.|.|||.|..||..|:.|..
Human    80 LCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQ 144

  Fly   138 TPLKREQGQKLANKIRAVKYMECSALT-QRGLKPVFEEAVRAVL-RPEPLKRR 188
            .|:..|||..:|.::.|..|:|.||.| ::.:..:|..|....| :|.||.::
Human   145 APISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 69/174 (40%)
RND1NP_055285.1 Rnd1_Rho6 1..232 CDD:206737 73/183 (40%)
Effector region. /evidence=ECO:0000255 42..50 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.