DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhof

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_780301.1 Gene:Rhof / 23912 MGIID:1345629 Length:211 Species:Mus musculus


Alignment Length:197 Identity:87/197 - (44%)
Similarity:122/197 - (61%) Gaps:3/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQED 66
            |..:.:|.|:||||..|||.:|:.|....||..|.|:||:.|:|.:.|...:|:|.|:|||||||
Mouse    15 SARKELKIVIVGDGGCGKTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNLYDTAGQED 79

  Fly    67 YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSG 131
            |||||||||..|.:.||||.|.:|:|::||..||:||:.|.|...|.:|:|.|.|||:|:|.|..
Mouse    80 YDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPTVLIGCKTDLRKDKEQLRK 144

  Fly   132 LAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRK---CL 193
            |....|.|:...||.....::|...|:||||..:..::.||.||.:..|......:||:|   ||
Mouse   145 LRAAQLEPITYTQGLNACEQMRGALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKHRICL 209

  Fly   194 IM 195
            ::
Mouse   210 LL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 80/172 (47%)
RhofNP_780301.1 Rho4_like 17..211 CDD:206704 86/193 (45%)
Effector region. /evidence=ECO:0000255 48..56 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.