DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rac3

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_573486.1 Gene:Rac3 / 170758 MGIID:2180784 Length:192 Species:Mus musculus


Alignment Length:188 Identity:129/188 - (68%)
Similarity:159/188 - (84%) Gaps:0/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            |||||||||.|||||:||||||:.|||||:|||||||||.:.||...|:||||||||||||||||
Mouse     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLR 68

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            |||||||||||||:|:.||:|||||.:|||||::||||..||:|||||:|||:|::|:..|.::.
Mouse    69 PLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKK 133

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKCLI 194
            |.|:...||..:|.:|.:|||:|||||||||||.||:||:||||.|.|:|:..:||.:
Mouse   134 LAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 122/172 (71%)
Rac3NP_573486.1 Rac1_like 3..176 CDD:206663 121/171 (71%)
Effector region. /evidence=ECO:0000255 32..40 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100633
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.