DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhod

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_031511.1 Gene:Rhod / 11854 MGIID:108446 Length:210 Species:Mus musculus


Alignment Length:195 Identity:87/195 - (44%)
Similarity:125/195 - (64%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDY 67
            :|..:|.|:||||..|||.:::.:....||..|.||||:.|:|.:|:....|.|.:||||||:||
Mouse    14 SGHSVKVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDY 78

  Fly    68 DRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGL 132
            ||||||.||..:|.|:|:.|.:|:||:||:::||||:.|.|...|||:||.|||||:|:..::.|
Mouse    79 DRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNL 143

  Fly   133 AEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL--RPEPLKRR--QRKCL 193
            .::.|.|:...:|..:|..:.||.|:||||.....::.||:||....|  |.....||  |..||
Mouse   144 RKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSRRHNFWRRITQNCCL 208

  Fly   194  193
            Mouse   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 79/174 (45%)
RhodNP_031511.1 Rho4_like 17..208 CDD:206704 84/190 (44%)
RHO 20..192 CDD:197554 78/171 (46%)
Effector region. /evidence=ECO:0000255 46..54 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.