DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and Rhoa

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_476473.1 Gene:Rhoa / 117273 RGDID:619921 Length:193 Species:Rattus norvegicus


Alignment Length:191 Identity:110/191 - (57%)
Similarity:135/191 - (70%) Gaps:7/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLRP 72
            |.|:||||..||||:||.::.|.||..||||||:||.|.::||..||.|.|||||||||||||||
  Rat     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71

  Fly    73 LSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQGL 137
            ||||.|||.|:|:|:.||.|.||:..||.||:||.||:.||||||.|.|||.|..|...||:...
  Rat    72 LSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQ 136

  Fly   138 TPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRK---CLIM 195
            .|:|.|:|:.:||:|.|..||||||.|:.|::.|||.|.||.|:    .||.:|   |||:
  Rat   137 EPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ----ARRGKKKSGCLIL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 103/172 (60%)
RhoaNP_476473.1 RhoA_like 5..179 CDD:206662 103/171 (60%)
Effector region. /evidence=ECO:0000255 34..42 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.