DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and LOC100537765

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_021326673.1 Gene:LOC100537765 / 100537765 -ID:- Length:157 Species:Danio rerio


Alignment Length:156 Identity:100/156 - (64%)
Similarity:124/156 - (79%) Gaps:9/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VDTIQVSLGLWDTAGQEDYDRLRPLSYPQT---------DVFLICYSVASPSSFENVTSKWYPEI 104
            ||...|:|||||||||||||||||||||||         ||||||:|:.||:|||||.:|||||:
Zfish     2 VDGKPVNLGLWDTAGQEDYDRLRPLSYPQTFNVNAFLSQDVFLICFSLVSPASFENVRAKWYPEV 66

  Fly   105 KHHCPDAPIILVGTKIDLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLK 169
            :|||...||||||||:|||:|::|:..|.|:.|||:...||..:|.:|.||||:|||||||||||
Zfish    67 RHHCQTTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLK 131

  Fly   170 PVFEEAVRAVLRPEPLKRRQRKCLIM 195
            .||:||:||||.|.|:|:|:|||.::
Zfish   132 TVFDEAIRAVLCPPPVKKRKRKCSLL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 93/141 (66%)
LOC100537765XP_021326673.1 P-loop_NTPase <1..141 CDD:328724 90/138 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.