DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhobtb1

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_003199615.1 Gene:rhobtb1 / 100537290 ZFINID:ZDB-GENE-130530-871 Length:687 Species:Danio rerio


Alignment Length:219 Identity:80/219 - (36%)
Similarity:118/219 - (53%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTGRP----IKCVVVGDGTVGKTCMLISYTTDCFPGEY------VPTVF--DNYSAPMQ----- 48
            |...||    ||||||||..||||.::.:...:....:|      ||||:  |.|....:     
Zfish     1 MDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERS 65

  Fly    49 ---VDTIQVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPD 110
               ||.:.|||.||||.|  |:.:.|..:|.::||.::|:|:|:|:|..:|.:.||.||||.||.
Zfish    66 RDVVDDVSVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYLEIKHFCPR 128

  Fly   111 APIILVGTKIDLR-EDRETLSGLAEQGLTPLKR----------EQGQKLANKIRAVKYMECSALT 164
            .|:||||.::||| .|.|.::    :...||.|          |.|:::|.:: .:.|.|.|...
Zfish   129 TPVILVGCQLDLRYADLEAVN----RARRPLSRPIKPGDILPPESGREVAKEL-GIPYYETSVFD 188

  Fly   165 QRGLKPVFEEAVRAVLRPEPLKRR 188
            |.|:|.:|:.|:||.|    :.||
Zfish   189 QFGIKDIFDNAIRAAL----ISRR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 73/199 (37%)
rhobtb1XP_003199615.1 RhoBTB 9..203 CDD:133275 73/200 (37%)
BTB 355..446 CDD:333434
BTB 477..569 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.