DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhoh

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001120435.1 Gene:rhoh / 100145522 XenbaseID:XB-GENE-950965 Length:190 Species:Xenopus tropicalis


Alignment Length:187 Identity:79/187 - (42%)
Similarity:118/187 - (63%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            ||||:|||..||||.:|:.:|::.||..|.|||::|....:.:|.:|:|||||||||.:.:..:|
 Frog     4 IKCVLVGDAAVGKTALLVRFTSEAFPDSYRPTVYENTGVDVYMDGVQISLGLWDTAGNDAFRSIR 68

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            |||....|:.|:|:|||:.:||.||.:||..|::.|.|..|:::|.|:.|.||       |....
 Frog    69 PLSLQNADIVLLCFSVANHTSFLNVRNKWIGEVRQHLPRIPVLVVATQTDQRE-------LDHMR 126

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKCL 193
            |..:....|::||..:||..|:|||||:.||::.|||.|||..:.....:.|:.:.|
 Frog   127 LPCINSIDGKQLAQDVRAKGYLECSALSNRGVQQVFECAVRTAINQAKKRARRHRFL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 75/172 (44%)
rhohNP_001120435.1 Rho 4..168 CDD:206641 76/170 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.