DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhoj

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_017952315.1 Gene:rhoj / 100125013 XenbaseID:XB-GENE-957540 Length:214 Species:Xenopus tropicalis


Alignment Length:199 Identity:111/199 - (55%)
Similarity:139/199 - (69%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STG--------RPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGL 58
            |||        |.:||||||||.|||||:|:||..|.||.:|||||||:|:..:.|...|..|||
 Frog     9 STGCSSMSSMKRMLKCVVVGDGAVGKTCLLMSYANDAFPEQYVPTVFDHYAVTITVGGKQYLLGL 73

  Fly    59 WDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLR 123
            :|||||||||:|||||||.|||||||:||.:|:|:.||..:|..|::...|..|.:|:||:||||
 Frog    74 YDTAGQEDYDQLRPLSYPNTDVFLICFSVVNPASYHNVHEEWVSELRACMPHVPYVLIGTQIDLR 138

  Fly   124 EDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRR 188
            :|..||:.|......|:.:|||.|||..|.|..|:|||||||:|||.||:||:..|..|:..|||
 Frog   139 DDPITLARLLHMKEKPITQEQGMKLAKMIGAQCYLECSALTQKGLKNVFDEAILTVFHPKKKKRR 203

  Fly   189 QRKC 192
            ..||
 Frog   204 CVKC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 100/172 (58%)
rhojXP_017952315.1 Tc10 22..195 CDD:206707 100/172 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.