DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtl and rhov

DIOPT Version :9

Sequence 1:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001122131.1 Gene:rhov / 100038217 XenbaseID:XB-GENE-489435 Length:240 Species:Xenopus tropicalis


Alignment Length:175 Identity:93/175 - (53%)
Similarity:123/175 - (70%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLR 71
            ||||:||||.||||.::||||.:.:|.||.||..|.:|..:.||...|.:.|.|||||||:|.||
 Frog    37 IKCVLVGDGAVGKTSLVISYTINGYPTEYQPTALDTFSVQVLVDGAPVRIQLCDTAGQEDFDHLR 101

  Fly    72 PLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQG 136
            .|.|.:|||||:|:||.:||||:|||.||.|||:.|.|..||:||||:.|||:|...|..|:...
 Frog   102 SLCYAETDVFLVCFSVVNPSSFQNVTEKWIPEIRTHSPHTPIVLVGTQADLRDDVNVLINLSRSH 166

  Fly   137 LTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLR 181
            :.|:...|.|.:|.||||..|:|||||||:.||.||:.::.:.::
 Frog   167 VKPVSESQAQAVAQKIRAQTYIECSALTQKNLKEVFDASILSAIK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtlNP_524533.1 RHO 9..182 CDD:197554 91/173 (53%)
rhovNP_001122131.1 Wrch_1 37..209 CDD:133330 93/171 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.