DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5611 and AIM1

DIOPT Version :10

Sequence 1:NP_651574.1 Gene:CG5611 / 43318 FlyBaseID:FBgn0039531 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_194630.1 Gene:AIM1 / 829022 AraportID:AT4G29010 Length:721 Species:Arabidopsis thaliana


Alignment Length:30 Identity:8/30 - (26%)
Similarity:16/30 - (53%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LGVIRPDVSAIGNPGNLTFSD--PVEAVRE 200
            ||.:...:|.:.:..::|..|  |:|:..|
plant   132 LGCVAVPLSQLVDAADMTIEDWLPLESTEE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5611NP_651574.1 crotonase-like 39..256 CDD:474030 8/30 (27%)
AIM1NP_194630.1 fadJ 8..708 CDD:236864 8/30 (27%)

Return to query results.
Submit another query.