DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tusp and TLP4

DIOPT Version :10

Sequence 1:NP_001263014.1 Gene:Tusp / 43317 FlyBaseID:FBgn0039530 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_001321047.1 Gene:TLP4 / 842489 AraportID:AT1G61940 Length:265 Species:Arabidopsis thaliana


Alignment Length:101 Identity:23/101 - (22%)
Similarity:41/101 - (40%) Gaps:28/101 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1315 KQYRDLETF--------------QKAQLRQKLKRGKIEPNGSA----------SCANPAPVRR-E 1354
            |:.|..:||              :.::..:.:.:..::|.|:|          |..:|:..:. .
plant    74 KRNRSNQTFYLYLGGEAKIFCQSEPSEPNKSIWKLSLKPGGTATTQTELDNFVSFRSPSGQKEGV 138

  Fly  1355 FVMHNKAPMWNEMSQVYQLDFGG-RVTQESAKNFQI 1389
            .|:.:|.|...|.|  :.|||.| |....|.|.||:
plant   139 LVLKSKVPRLEEQS--WCLDFNGWRDIVSSGKKFQL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TuspNP_001263014.1 WD40 <81..221 CDD:441893
WD40 repeat 91..126 CDD:293791
WD40 repeat 132..168 CDD:293791
WD40 repeat 173..208 CDD:293791
WD40 repeat 216..263 CDD:293791
WD40 repeat 270..333 CDD:293791
Tub <1249..1426 CDD:460094 23/101 (23%)
TLP4NP_001321047.1 F-box_SF 1..42 CDD:459239
Tub 60..174 CDD:460094 23/101 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.