DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tusp and TULP3

DIOPT Version :9

Sequence 1:NP_001263014.1 Gene:Tusp / 43317 FlyBaseID:FBgn0039530 Length:1433 Species:Drosophila melanogaster
Sequence 2:NP_001153880.1 Gene:TULP3 / 7289 HGNCID:12425 Length:501 Species:Homo sapiens


Alignment Length:443 Identity:105/443 - (23%)
Similarity:153/443 - (34%) Gaps:142/443 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1067 SPSSACKRCQPSASSVLDEITAVVPAVEPAK-------ESPAVQAKP----APKKRFDVITSFTD 1120
            :|.:..:|.:|.||   ||.|.:|....|..       :.||...||    ||.....|:..   
Human    52 NPEARLRRAKPRAS---DEQTPLVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEE--- 110

  Fly  1121 SPLFTRKHRFGIGRSKETAGTENSTPLLGRKQDNGFSFVKQLSEVRWRRKEQPAQAQVNGSSNAS 1185
                         .::.|..|.:...|..|.|.:..|......|            :.:|.|.::
Human   111 -------------DAENTVDTASKPGLQERLQKHDISESVNFDE------------ETDGISQSA 150

  Fly  1186 TLERQPQPEITGAACGTVEATPVEAKASVSLHTQALTTLENIISRLRDLDEGRLTPPSTPQ---- 1246
            .|||   |....:...|...|...|.|:        ...:|::..:.||::...:|  .||    
Human   151 CLER---PNSASSQNSTDTGTSGSATAA--------QPADNLLGDIDDLEDFVYSP--APQGVTV 202

  Fly  1247 --RLPRSS--------PASPAASKKNKRQQSNSPIRHILNSPLLNRRQRKKQSI------IESSD 1295
              |:.|..        |......:|.:.|:..          ||..|:|||...      |:..|
Human   203 RCRIIRDKRGMDRGLFPTYYMYLEKEENQKIF----------LLAARKRKKSKTANYLISIDPVD 257

  Fly  1296 --DEGNQTNGSGEESNNAGNGKQYRDLETFQK-------------AQLRQKLKRGKIEPN----- 1340
              .||....|. ..||..|.     ....:.:             |..||:|.....|.|     
Human   258 LSREGESYVGK-LRSNLMGT-----KFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFK 316

  Fly  1341 ----------GSASCANPAPVRRE------------------FVMHNKAPMWNEMSQVYQLDFGG 1377
                      |........|.:.:                  ..:|||||:||..:|.|.|:|.|
Human   317 GPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRG 381

  Fly  1378 RVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALAN 1427
            ||||.|.|||||..:...   ||||||:..:.:|||:.||..|:|||.:.|::
Human   382 RVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TuspNP_001263014.1 WD40 51..>295 CDD:225201
WD40 81..359 CDD:295369
WD40 repeat 91..126 CDD:293791
WD40 repeat 132..168 CDD:293791
WD40 repeat 173..208 CDD:293791
WD40 repeat 216..263 CDD:293791
WD40 repeat 270..333 CDD:293791
Tub <588..>644 CDD:279506
Tub <1355..1426 CDD:279506 37/73 (51%)
TULP3NP_001153880.1 Required for association with the IFT complex A (IFT-A) 23..68 6/18 (33%)
Tub_N 31..169 CDD:292938 31/150 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..177 19/114 (17%)
Tub 195..435 CDD:279506 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.