DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tusp and tulp1b

DIOPT Version :9

Sequence 1:NP_001263014.1 Gene:Tusp / 43317 FlyBaseID:FBgn0039530 Length:1433 Species:Drosophila melanogaster
Sequence 2:XP_021332987.1 Gene:tulp1b / 571108 ZFINID:ZDB-GENE-110411-113 Length:316 Species:Danio rerio


Alignment Length:311 Identity:54/311 - (17%)
Similarity:105/311 - (33%) Gaps:107/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1102 VQAKPAPKKR----FDVITSFTDS-PLFTRKHRFGIGRSKETAGTENSTPLLGRKQDNGFSFVKQ 1161
            :.|:..|||:    ....|:.:|: |..|:..:.|...::.:..|:|......:|.|..    |:
Zfish     1 MSAEKKPKKKKPESIPAETNGSDAKPKKTKMKKSGDQSTESSPATQNGEKTKKKKLDKD----KE 61

  Fly  1162 LSEVRWRRKEQPAQAQVNGSSNASTLERQPQPEITGAACGTVEATPVEAKASVSLHTQALTTLEN 1226
            .:|   :.||...:|                           ::.|.:.|:|......       
Zfish    62 STE---KEKETKKKA---------------------------KSAPKKKKSSTDDDDD------- 89

  Fly  1227 IISRLRDLDEGRLTPPSTPQRLPRSSPASPAASKKNKRQQSNSPIR------------------- 1272
                  |.|:|.    :|||:..:..||..::..|.|.::.:...:                   
Zfish    90 ------DEDDGE----TTPQKKTKKKPAKESSDTKEKEKEKDKKSKSKDAKEDADSKGKSKTKKK 144

  Fly  1273 -----HILNSPLLNRRQRKKQSIIESSDDEGNQTNGSGEESNNAGN--------GKQYRDLETFQ 1324
                 ..:|......:.:||.:..||.::...:|..|..:..::.|        |.:.:|.:|.:
Zfish   145 EPASMFQINGEKPETKSKKKAAKSESEEESEPETKTSKTKKKSSSNTASMFQTGGDKDKDKKTKK 209

  Fly  1325 -------------KAQLRQKLKRGKIEPNGSASCANPAPV-----RREFVM 1357
                         .:::.||.|:|| ...|......|:||     ..|||:
Zfish   210 TKSSAKAEETEDSDSEVTQKKKKGK-GKKGKKEERAPSPVIEFNNLEEFVL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TuspNP_001263014.1 WD40 51..>295 CDD:225201
WD40 81..359 CDD:295369
WD40 repeat 91..126 CDD:293791
WD40 repeat 132..168 CDD:293791
WD40 repeat 173..208 CDD:293791
WD40 repeat 216..263 CDD:293791
WD40 repeat 270..333 CDD:293791
Tub <588..>644 CDD:279506
Tub <1355..1426 CDD:279506 2/3 (67%)
tulp1bXP_021332987.1 Tub 261..>316 CDD:307359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.