DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tusp and LOC110439885

DIOPT Version :9

Sequence 1:	NP_001263014.1	Gene:	Tusp / 43317	FlyBaseID:	FBgn0039530	Length:	1433	Species:	Drosophila melanogaster
Sequence 2:	XP_021333037.1	Gene:	LOC110439885 / 110439885	-ID:	-	Length:	214	Species:	Danio rerio

Alignment Length:	74	Identity:	40/74 - (54%)
Similarity:	53/74 - (71%)	Gaps:	3/74 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly  1357 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSAL 1418
            :.||.|:|||.:..:.|:|.|||||.|.|||||.....|   |||||||..:|:|||::||..|:
Zfish   133 LRNKTPVWNEETASHVLNFNGRVTQASIKNFQIVHNKDQDYIVMQFGRIADDAFTLDYRYPLCAV 197

  Fly  1419 QAFAVALAN 1427
            ||||:||::
Zfish   198 QAFAIALSS 206

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tusp	NP_001263014.1	WD40	51..>295	CDD:225201
		WD40	81..359	CDD:295369
		WD40 repeat	91..126	CDD:293791
		WD40 repeat	132..168	CDD:293791
		WD40 repeat	173..208	CDD:293791
		WD40 repeat	216..263	CDD:293791
		WD40 repeat	270..333	CDD:293791
		Tub	<588..>644	CDD:279506
		Tub	<1355..1426	CDD:279506	39/71 (55%)
LOC110439885	XP_021333037.1	Tub	6..207	CDD:307359	40/74 (54%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1445357at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010