powered by:
Protein Alignment Tusp and LOC110439885
DIOPT Version :9
Sequence 1: | NP_001263014.1 |
Gene: | Tusp / 43317 |
FlyBaseID: | FBgn0039530 |
Length: | 1433 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021333037.1 |
Gene: | LOC110439885 / 110439885 |
-ID: | - |
Length: | 214 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 40/74 - (54%) |
Similarity: | 53/74 - (71%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1357 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSAL 1418
:.||.|:|||.:..:.|:|.|||||.|.|||||.....| |||||||..:|:|||::||..|:
Zfish 133 LRNKTPVWNEETASHVLNFNGRVTQASIKNFQIVHNKDQDYIVMQFGRIADDAFTLDYRYPLCAV 197
Fly 1419 QAFAVALAN 1427
||||:||::
Zfish 198 QAFAIALSS 206
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1445357at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.