| Sequence 1: | NP_001263013.1 | Gene: | dsd / 43315 | FlyBaseID: | FBgn0039528 | Length: | 1323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006540177.1 | Gene: | Tmem145 / 330485 | MGIID: | 3607779 | Length: | 604 | Species: | Mus musculus |
| Alignment Length: | 234 | Identity: | 44/234 - (18%) |
|---|---|---|---|
| Similarity: | 69/234 - (29%) | Gaps: | 91/234 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 565 AKCYSQDLLVYDVYCDSWHYHPMPGHLQA-DLARFGHSSVVFEESLYIYGGFNGQLLNDMLRYQP 628
Fly 629 GYCSYY----TKQEKCTAARPGVKCI----WDVQKMRCIAITQVQRSAIYGRE----QYDYVACP 681
Fly 682 SKS-----------------------------------RLTLTSELLHDVHRCQELASCQSCVST 711
Fly 712 AFGCTY--------CGNGVCSKERCRETTSMASVFFESS 742 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dsd | NP_001263013.1 | CUB | 86..212 | CDD:238001 | |
| PLN02153 | 290..582 | CDD:177814 | 6/16 (38%) | ||
| KELCH repeat | 308..349 | CDD:276965 | |||
| Kelch_5 | 355..391 | CDD:290565 | |||
| KELCH repeat | 358..420 | CDD:276965 | |||
| KELCH repeat | 424..474 | CDD:276965 | |||
| KELCH repeat | 482..531 | CDD:276965 | |||
| KELCH repeat | 535..588 | CDD:276965 | 7/22 (32%) | ||
| PSI | 821..870 | CDD:279745 | |||
| EGF_Lam | 948..994 | CDD:238012 | |||
| EGF_Lam | 995..1040 | CDD:238012 | |||
| Tmem145 | XP_006540177.1 | GpcrRhopsn4 | 157..411 | CDD:370872 | 20/116 (17%) |
| PHA03247 | <476..599 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1388 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||