DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsd and Pafah1b3

DIOPT Version :9

Sequence 1:NP_001263013.1 Gene:dsd / 43315 FlyBaseID:FBgn0039528 Length:1323 Species:Drosophila melanogaster
Sequence 2:NP_001344279.1 Gene:Pafah1b3 / 18476 MGIID:108414 Length:232 Species:Mus musculus


Alignment Length:231 Identity:43/231 - (18%)
Similarity:67/231 - (29%) Gaps:77/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 WETVHPEDGSEVPDKRYGASTVMYGDKIFM-------------------YGGVVKGHGISNELWA 388
            |.::|....::..||.  ...|..||.:..                   :|  :.|....:.||.
Mouse    24 WMSLHHRFVADSKDKE--PEVVFIGDSLVQLMHQCEIWRELFSPLHALNFG--IGGDSTQHVLWR 84

  Fly   389 FDVS---------ARTWANISVRADPSCNATGGTTAMCGPLHVVGHTATLVPGYGDKNNYQYMVV 444
            .:..         ...|...:..:..:...|||..|:          ..||    :|...|..||
Mouse    85 LENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAI----------VQLV----NKLQPQARVV 135

  Fly   445 IFGHSPNYGYLNTVQEFNFASREWRIVPTTGYV------VKGGYGHSAAYDFLTEKVYVYGGIVS 503
            :.|..|...:.|.::|.|....|.......||.      ...|:.||             .|.:|
Mouse   136 VLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHS-------------DGTIS 187

  Fly   504 ESESSQVLSSRLYAYEPATRVWSLLSAAPSARLLHT 539
            ..:        :|.|...:|    |...|..|.||:
Mouse   188 HHD--------MYDYLHLSR----LGYTPVCRALHS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsdNP_001263013.1 CUB 86..212 CDD:238001
PLN02153 290..582 CDD:177814 43/231 (19%)
KELCH repeat 308..349 CDD:276965 2/5 (40%)
Kelch_5 355..391 CDD:290565 9/54 (17%)
KELCH repeat 358..420 CDD:276965 12/89 (13%)
KELCH repeat 424..474 CDD:276965 12/49 (24%)
KELCH repeat 482..531 CDD:276965 8/48 (17%)
KELCH repeat 535..588 CDD:276965 3/5 (60%)
PSI 821..870 CDD:279745
EGF_Lam 948..994 CDD:238012
EGF_Lam 995..1040 CDD:238012
Pafah1b3NP_001344279.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PAF_acetylesterase_like 8..206 CDD:238858 40/224 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.