DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dsd and C15A7.2

DIOPT Version :9

Sequence 1:	NP_001263013.1	Gene:	dsd / 43315	FlyBaseID:	FBgn0039528	Length:	1323	Species:	Drosophila melanogaster
Sequence 2:	NP_510017.3	Gene:	C15A7.2 / 182623	WormBaseID:	WBGene00007595	Length:	513	Species:	Caenorhabditis elegans

Alignment Length:	164	Identity:	32/164 - (19%)
Similarity:	55/164 - (33%)	Gaps:	70/164 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly   152 HLYIYDGDSVDSPLLAVFSGLMYRGNFSIR----------RVPQVIATSGTALVHFFSDDAYNMS 206
            |:||..|..... :|:.....:|...|..:          |.|....|. ..|::|.::|.:..:
Worm    20 HIYIAQGKRAQG-ILSSKRDFVYLDRFCFQSDTGALEYTFRYPMFYPTQ-MLLLYFDTEDQWPRA 82

  Fly   207 GFNLTYK-MNSCP---------SDSDEV--------ECSGHGKCR---DG------DCI------ 238
                 || :|:|.         |::.::        :.||:|:|:   ||      .|.
Worm    83 -----YKELNTCEDRVQLLANHSENHQIIYLSPYALDSSGNGRCQIHSDGLGQQWIACSGTRVFR 142

  Fly   239 -------------CDP-------MYRGEACNIAA 252
                         |||       :|..|:..|.|
Worm   143 SARSRWWFLAIANCDPSESEDRRLYNNESIGIYA 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dsd	NP_001263013.1	CUB	86..212	CDD:238001	13/69 (19%)
		PLN02153	290..582	CDD:177814
		KELCH repeat	308..349	CDD:276965
		Kelch_5	355..391	CDD:290565
		KELCH repeat	358..420	CDD:276965
		KELCH repeat	424..474	CDD:276965
		KELCH repeat	482..531	CDD:276965
		KELCH repeat	535..588	CDD:276965
		PSI	821..870	CDD:279745
		EGF_Lam	948..994	CDD:238012
		EGF_Lam	995..1040	CDD:238012
C15A7.2	NP_510017.3	GpcrRhopsn4	173..429	CDD:370872	2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1388
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900