powered by:
Protein Alignment CG5639 and Wfdc11
DIOPT Version :9
Sequence 1: | NP_651570.1 |
Gene: | CG5639 / 43314 |
FlyBaseID: | FBgn0039527 |
Length: | 1511 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001240606.1 |
Gene: | Wfdc11 / 685227 |
RGDID: | 1596469 |
Length: | 84 |
Species: | Rattus norvegicus |
Alignment Length: | 63 |
Identity: | 16/63 - (25%) |
Similarity: | 19/63 - (30%) |
Gaps: | 19/63 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 786 CPYLVPP---------GPDNL---------DANTCAYECRTDAHCDGARR-CCSNGCGTQCVD 829
|..|:|| .|..| .||.|..:|.....|..... ||...||..|.:
Rat 13 CVLLLPPALGGTKNKYSPGELLLEECWGQPKANDCTKKCSRTFKCVYRNHTCCWTYCGNICAE 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166343534 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19441 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.