DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and Wfdc9

DIOPT Version :10

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:XP_006500047.3 Gene:Wfdc9 / 629754 MGIID:3652032 Length:126 Species:Mus musculus


Alignment Length:69 Identity:18/69 - (26%)
Similarity:28/69 - (40%) Gaps:22/69 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 SLREDLDCLDLTCRMGCEYGFSLDPDTR-CPACQCRDPCEGVTCGSGKECRVVDVSCEGEYCPPV 775
            ||::||:.:| .|        .:.|.|| |          |..|...::|...:.:|...||..:
Mouse    67 SLKDDLEEID-QC--------WVQPPTRFC----------GKRCTKVRKCVSPNYTCCWTYCGNI 112

  Fly   776 PACL 779
              ||
Mouse   113 --CL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672
TY 836..903 CDD:238114
Antistasin 911..936 CDD:460713
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
Wfdc9XP_006500047.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.