DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and wfdc2

DIOPT Version :10

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:NP_001373404.1 Gene:wfdc2 / 556600 ZFINID:ZDB-GENE-090313-47 Length:168 Species:Danio rerio


Alignment Length:221 Identity:58/221 - (26%)
Similarity:71/221 - (32%) Gaps:81/221 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LDCLDLTCRMGCEYGFSLDP---DT---RCP----------ACQCRDPCEGVTCGSGKECRVVDV 765
            |..|...|..||.......|   ||   .||          .|.....|.|     |.:|.|.| 
Zfish    10 LSALFFLCLSGCWSSLLAAPRLNDTVVLHCPGKLTVMPSSRGCASDRDCSG-----GHKCCVFD- 68

  Fly   766 SCEGEYCPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP 830
             | |..|.| ||.  .|||.||:      ....|..||..|..|::|....:|||||||.:|..|
Zfish    69 -C-GAVCVP-PAF--TKPGVCPH------RRFGAGMCAEYCVNDSNCPSNEKCCSNGCGHECTPP 122

  Fly   831 QLKTACQHLQAIQLHQSSELGIPARQMAVAQCDPNNGKWNQVQCSPDGHCWCVDDQGKILPGTRV 895
            ..                   :...:.|:.:..|...::    |..||.|               
Zfish   123 YT-------------------VKPGRCALPRGTPMCAEY----CYHDGQC--------------- 149

  Fly   896 KSPATPKCQENSSFACPKTNCSLECE 921
              ||..||       || |.|...|:
Zfish   150 --PAKQKC-------CP-TTCGHACD 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672 19/47 (40%)
TY 836..903 CDD:238114 8/66 (12%)
Antistasin 911..936 CDD:460713 5/11 (45%)
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
wfdc2NP_001373404.1 WAP 80..122 CDD:459672 19/47 (40%)
WAP 126..167 CDD:459672 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.