powered by:
Protein Alignment CG5639 and Wfdc15b
DIOPT Version :9
Sequence 1: | NP_651570.1 |
Gene: | CG5639 / 43314 |
FlyBaseID: | FBgn0039527 |
Length: | 1511 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001382049.1 |
Gene: | Wfdc15b / 408230 |
RGDID: | 1303042 |
Length: | 80 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 19/49 - (38%) |
Similarity: | 23/49 - (46%) |
Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 782 KPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP 830
|||.||....|.|..| ..:||.|..|.|:.:||...|..:||.|
Rat 32 KPGFCPEFHLPCPFVL-----VPKCRRDRGCSGSLKCCFYYCQMRCVVP 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.